PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC01G32670.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 735aa    MW: 80964.4 Da    PI: 7.6544
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC01G32670.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox43.36.3e-1468122256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      r+ +++t++q e+Le +F  + +p+  ++++L++ +gL  +qVk+WFqN+R++ k
  OPUNC01G32670.1  68 RRLQRLTSKQSEVLEGFFSICGHPDDGQKRHLSETTGLGLDQVKFWFQNKRTQVK 122
                      555789*********************************************9877 PP

2START88.91.1e-282224372205
                      HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S...EEEEEE CS
            START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla...kaetle 83 
                      la  a+ +l+ +a++  ++W+ ++    e +n++ + q  + +++     +++ea ra+ +v m+   +v  l+d    + + ++   + ++++
  OPUNC01G32670.1 222 LAKNAMHALIILAESHVALWFPVPgcsyEVLNKMAYDQAYPGDNSanamgFKTEATRAVSMVMMDYKSVVDFLMDPY-NYRTFFPevlSGAVTN 314
                      6788999999**************999988888888888866666888999****************6665555555.6666666555888888 PP

                      EECTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE- CS
            START  84 vissg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwveh 169
                      +i s        g++qlm+ e++++splvp R+ +f+Ry+  l++g  v+ dvS++  +  +      ++++ pSg+li++  ++ +kvt +eh
  OPUNC01G32670.1 315 RIYSWptsdgynGVIQLMTVEMMFPSPLVPaRKCTFLRYCNVLNEGLVVVIDVSLNDGSVFS------KCRKMPSGFLIQSIRQNTCKVTAIEH 402
                      8877677779******************************************9998877755......7************************* PP

                      EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
            START 170 vdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                      v  ++  +h+l+++ + sgl++ga++wvat+ rq +
  OPUNC01G32670.1 403 VLADDTGVHELYQPCM-SGLVFGARRWVATMARQSA 437
                      **************87.79************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-1555118IPR009057Homeodomain-like
SuperFamilySSF466891.11E-1559126IPR009057Homeodomain-like
PROSITE profilePS5007114.47964124IPR001356Homeobox domain
SMARTSM003897.9E-1166128IPR001356Homeobox domain
CDDcd000867.58E-1367124No hitNo description
PfamPF000461.5E-1168122IPR001356Homeobox domain
PROSITE patternPS00027099122IPR017970Homeobox, conserved site
PROSITE profilePS5084819.531212441IPR002913START domain
CDDcd088757.74E-93216437No hitNo description
SMARTSM002342.5E-7221438IPR002913START domain
PfamPF018527.0E-22222437IPR002913START domain
SuperFamilySSF559613.63E-19271437No hitNo description
SuperFamilySSF559618.13E-8463664No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 735 aa     Download sequence    Send to blast
MEMNQQHNEG NESFVALMNG VAGDGTATRS NDEEQSMSIP TRELFAAIEA DSGLSPGNSS  60
NTNEKKKRRL QRLTSKQSEV LEGFFSICGH PDDGQKRHLS ETTGLGLDQV KFWFQNKRTQ  120
VKTMCWKEEN YKLTVENQIL RDENRRVKIA HCTAICLTCR NSSVQDQLAV EMERLMGQSE  180
WLQQEIARSN GTPPAANLAF QLNSSADYVF SGQHDQQMIA ELAKNAMHAL IILAESHVAL  240
WFPVPGCSYE VLNKMAYDQA YPGDNSANAM GFKTEATRAV SMVMMDYKSV VDFLMDPYNY  300
RTFFPEVLSG AVTNRIYSWP TSDGYNGVIQ LMTVEMMFPS PLVPARKCTF LRYCNVLNEG  360
LVVVIDVSLN DGSVFSKCRK MPSGFLIQSI RQNTCKVTAI EHVLADDTGV HELYQPCMSG  420
LVFGARRWVA TMARQSARLR DVHLNKTAPQ VSTKGRKNLI KLADDLLASF AGSIAATGGG  480
TWTVVIGAGT EKDIRVAYRR TTEGSSSYNA ILSVSTSLRL PLPMRKTFDL LRNLTHRCKW  540
DVLVHGSVVK EEVIIARGVG NDDTVTVLHC KRAGREDKGR TMILQNNGYD ASGSFMVYSQ  600
IDSELMNTMV LSPSDLLPGR GGPSLYPTGF SLLPDGEAAQ DSSGIALGEV GGTLMTMGFQ  660
IPVKLAGWEG MNSRSAASAI RLMTDTIAIV KKTLMNEHSG IYGGEKGGLC ADKIQEHAKV  720
IHRLRSSCIS QNLLN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16468KKKRR
26469KKKRRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3178820.0AF317882.1 Oryza sativa transcription factor 1 (TF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015632244.10.0PREDICTED: homeobox-leucine zipper protein TF1
SwissprotQ5ZAY00.0TF1_ORYSJ; Homeobox-leucine zipper protein TF1
TrEMBLA0A0E0JPP70.0A0A0E0JPP7_ORYPU; Uncharacterized protein
STRINGBGIOSGA004593-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104752833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.11e-110protodermal factor 2